PAK2KD (recombinant human PAK2 kinase domain)
본문
PAK2KD(recombinant human PAK2 kinase domain)
A. Product detail
1. Description :
Human PAK2 kinase (UniProt: Q13177; NCBI: NM_002577) belongs to a family of p21-activated kinases. These serine/
threonine kinases are regulated by the small GTP binding proteins Cdc42 and Rac and have been implicated in a wide
range of biological activities. PAK2 is activated by proteolytic cleavage during caspase-mediated apoptosis, and may play a
role in regulating the apoptotic events in the dying cell.
PAK2KD is a recombinant wild type human PAK2 kinase domain (amino acids 227–524 of full-length human PAK2)
expressed in E. coli and purified to near homogeneity with high specific activity.
2. Molecular Mass and Phosphorylation :
The calculated mass is 33,510. PAK2KD is fully phosphorylated at T402 and partially phosphorylated at additional sites
2. Molecular Mass and Phosphorylation :
The calculated mass is 33,510. PAK2KD is fully phosphorylated at T402 and partially phosphorylated at additional sites
with measured mass of 33,593 (1P), 33,673 (2P), 33,753 (3P), and 33,834 (4P).
3. Applications :
Enzymatic studies, inhibitor screen, and selectivity profiling
High concentration available for crystallization
4. Stability and Storage :
Stable at -70℃ for 12 month from date of receipt. Protein should be thawed on ice. Protein can be flash-frozen in liquid nitrogen and stored at -70℃.
3. Applications :
Enzymatic studies, inhibitor screen, and selectivity profiling
High concentration available for crystallization
4. Stability and Storage :
Stable at -70℃ for 12 month from date of receipt. Protein should be thawed on ice. Protein can be flash-frozen in liquid nitrogen and stored at -70℃.
B. Data sheet
1. Sequence :
GPHMTDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKE
LKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLL
GMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRA
LYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLIMAAKEAMKSNR
GPHMTDEEIMEKLRTIVSIGDPKKKYTRYEKIGQGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKE
LKNPNIVNFLDSYLVGDELFVVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLL
GMEGSVKLTDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMVEGEPPYLNENPLRA
LYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGSAKELLQHPFLKLAKPLSSLTPLIMAAKEAMKSNR
- The first 4 residues GPHM are from Turbo3C cleavage site.
- Phosphorylated at T402.
2. Component and Formulation :
PAK2KD: 1 mg/ml in Storage Buffer of 25 mM Tris-HCl pH8.0, 150 mM NaCl, 10% glycerol, 5 mM DTT.
3. Activity :
Specific activity: 85,806 pmoles/min/µg
>
- Phosphorylated at T402.
2. Component and Formulation :
PAK2KD: 1 mg/ml in Storage Buffer of 25 mM Tris-HCl pH8.0, 150 mM NaCl, 10% glycerol, 5 mM DTT.
3. Activity :
Specific activity: 85,806 pmoles/min/µg
>
Analysis of enzymatic activity was performed according to Zlyte assay protocol (Invitrogen):
- Different concentration of PAK2KD were incubated in a buffer containing 50 mM HEPES (pH7.5), 10 mM MgCl2, 1 mM EGTA, 200 mM ATP, 0.01% Brij-35, and 2 µM substrate (SER/THR 14, Invitrogen) at room temperature for 1 hour.
- Developer solution was added to reaction and reaction was stopped after 1h of incubation at RT.
- Fluorescence was detected using lexc=460±40 nm and lem=528±20 nm filters.
4. SDS-PAGE Analysis :
TurboNuclease (Benzonase equivalent, ultra-pure)
A. Product detail
1. Description :
TurboNuclease is a recombinant form of Serratia macescens extracellular endonuclease (encoded by the same gene of
Bezonase) produced in E. coli using a proprietary process. This nonspecific endonuclease hydrolyzes both single- and
double-stranded nucleic acids (DNA and RNA) to 5’-phosphorylated oligonucleotides of 1-4 bases in length.
TurboNuclease is a highly purified homodimer of 27 kDa subunits that has exceptional high specific activity and is free of
protease activity. TurboNuclease is ideal to digest nucleic acids and to reduce viscosity during protein purification and
sample preparation.
2. Protein Type :
2. Protein Type :
Endonuclease
3. Source :
3. Source :
E. coli
4. Unit Definition :
One unit of TurboNuclease converts 1.0 OD260 of salmon sperm DNA into acid-soluble nucleotides in 30 minutes at 37oC
4. Unit Definition :
One unit of TurboNuclease converts 1.0 OD260 of salmon sperm DNA into acid-soluble nucleotides in 30 minutes at 37oC
in a reaction buffer of 50 mM Tris-HCl, pH 8.0 and 1 mM MgCl2. This corresponds to complete digestion of 50 µg of
salmon sperm DNA into oligonucleotides. TurboNuclease has similar specific activity as Benzonase
5. Storage :
5. Storage :
Store TurboNuclease at -20oC.
6. Endotoxin Level :
< 0.1 EU / 1,000 units of TurboNuclease as determined by the Endo-Safe LAL Assay.
B. Data sheet
1. Formulation :
250 units/µl in 50 mM Tris-HCl, pH 8.0, 50 mM NaCl, 5 mM MgCl2 and 50% Glycerol
2. TurboNuclease Activity and Purity :
50 µg of salmon sperm DNA was incubated with the indicated units of TurboNuclease and another brand of nuclease at 37oC for 30 minutes in a buffer of 50 mM Tris-HCl, pH 8.0 and 1 mM MgCl2. DNA digestion was monitored by agarose gel.
TurboNuclease is purified through a proprietary process that achieves purity of >99%. TurboNuclease has no detectable protease activity.
Ordering information ;
1. 10 µg
2. 100 µg
3. 1 mg
4. Bulk 단위로도 공급이 가능합니다.(별도로 문의 바랍니다)
2. 100 µg
3. 1 mg
4. Bulk 단위로도 공급이 가능합니다.(별도로 문의 바랍니다)
* Concentration : 1 mg/ml
- 이전글Tag 절단 protease인 TurboTEV protease 12.06.01
- 다음글PAK1KD(recombinant human PAK1 kinase domain) 12.05.07
댓글목록
등록된 댓글이 없습니다.