Products

PAK6KD (recombinant human PAK6 kinase domain)

본문

PAK6KD (recombinant human PAK6 kinase domain) 
 
A. Product detail 
1. Description :
Human PAK6 kinase (UniProt: Q9NQU5; NCBI: NM_020168) belongs to a family of p21-activated kinases. These serine/
threonine kinases are regulated by the small GTP binding proteins Cdc42 and Rac and have been implicated in a wide
range of biological activities. PAK6 was found to interact with androgen receptor.
 
PAK6KD is a recombinant wild type human PAK6 kinase domain (amino acids 385–680 of full-length human PAK6)
expressed in E. coli and purified to homogeneity with full activity.
 
2. Molecular Mass and Phosphorylation :
The calculated mass is 34,161. PAK6KD is fully phosphorylated at S560 with a measured mass of 34,242 (1P).
 
3. Applications :
Enzymatic studies, inhibitor screen, and selectivity profiling
High concentration available for crystallization 
 
4. Stability and Storage :
Stable at -70°C for 12 months from date of receipt. Protein should be thawed on ice. Protein can be flash-frozen in liquid nitrogen and stored at -70°C. 

B. Data sheet 
1. Sequence :
GPHPVTHEQFKAALRMVVDQGDPRLLLDSYVKIGEGSTGIVCLAREKHSGRQVAVKMMDLRKQQRRELLFNEVVI
MRDYQHFNVVEMYKSYLVGEELWVLMEFLQGGALTDIVSQVRLNEEQIATVCEAVLQALAYLHAQGVIHRDIKSDSI
LLTLDGRVKLSDFGFCAQISKDVPKRK
SLVGTPYWMAPEVISRSLYATEVDIWSLGIMVIEMVDGEPPYFSDSPVQA
MKRLRDSPPPKLKNSHKVSPVLRDFLERMLVRDPQERATAQELLDHPFLLQTGLPECLVPLIQLYRKQTST
 
- The first 4 residues GPHP are from Turbo3C cleavage site.
- Phosphorylated at S560.
 
2. Component and Formulation :
PAK6KD: 1 mg/ml in Storage Buffer of 25 mM Tris-HCl pH8.0, 150 mM NaCl, 10% glycerol, 5 mM DTT.
 
3. Specific activity :
Specific activity: 2,086 pmoles/min/µg 
743602836_JQTIZjDY_Pak6KD_activity.jpg 
Analysis of enzymatic activity was performed according to Zlyte assay protocol (Invitrogen) : 
  1. Different concentration of PAK4KD were incubated in a buffer containing 50 mM HEPES (pH7.5), 10 mM MgCl2, 1 mM EGTA, 200 uM ATP, 0.01% Brij-35, and 2 µM substrate (SER/THR 14, Invitrogen) at room temperature for 1 hour.
  2. Developer solution was added to reaction and reaction was stopped after 1h of incubation at RT.
  3. Fluorescence was detected using λexc=460±40 nm and λem=528±20 nm filters.
4. SDS-PAGE Analysis : 
743602836_9GDptBe5_Pak6KD_gel.jpg
 
Ordering information ; 
1. 10 µg
2. 100 µg
3. 1 mg
4. Bulk 단위로도 공급이 가능합니다.(별도로 문의 바랍니다) 
* Concentration : 1 mg/ml
  
▣ 관련 페이지 ; Accelagen
 
 
 

댓글목록

등록된 댓글이 없습니다.

Copyright by Sambo Medical Co. All rights reserved.